McDonnell Genome Institute

Washington University

Transcript

SEC23A-AS1:17

Chromosome

chr14

Gene Name

SEC23A-AS1

Start

39108341

CPC Label

noncoding

End

39108707

Cancer

LUAD

Strand

+

Peptide

HTGPGILSMANAGPITNSSQFFICTAK

Modified Peptide

n[230]HTGPGILSMANAGPITNSSQFFICTAK

Peptide Length

27

ORF Length

116

Open Reading Frame (ORF)

LERKDWIISVPFFHRIIPGFMCQGGDFTCHNGTGGKSIYGEKFNNENFILKHTGPGILSMANAGPITNSSQFFICTAKTEWLDGRPCGLWQVERRHEYCGGHGVLWVQWQDQDHHC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

79

CPC Coding Probability

0.324619

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.370558057