McDonnell Genome Institute

Washington University

Transcript

SEC23A-AS1:10

Chromosome

chr14

Gene Name

SEC23A-AS1

Start

39102668

CPC Label

noncoding

End

39108934

Cancer

EOGC

Strand

+

Peptide

SPVLSTMVNPTVFFNIVVDGEPLGR

Modified Peptide

n[145]SPVLSTMVNPTVFFNIVVDGEPLGR

Peptide Length

25

ORF Length

66

Open Reading Frame (ORF)

LRKARGGRRHHCRSPVLSTMVNPTVFFNIVVDGEPLGRVSFKQFAEKFPKTAENSCSDHWRERIGL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.211139

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0945

PhyloCSF Frame 3

0

CNTI Score

-0.325989306