McDonnell Genome Institute

Washington University

Transcript

SCHLAP1:11

Chromosome

chr2

Gene Name

SCHLAP1

Start

180897765

CPC Label

noncoding

End

180921247

Cancer

EOGC

Strand

+

Peptide

APTLLSLR

Modified Peptide

n[145]APTLLSLR

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

MGRGIGTWISTLPRGTKAPTLLSLRCCQRRSNGESVL

Conservation Score

0.027

PhyloCSF Frame 1

-4.503

No. of Spectra

1

CPC Coding Probability

0.0621055

PhyloCSF Frame 2 

-5.141

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-6.027

CNTI Score

-0.376349757