McDonnell Genome Institute

Washington University

Transcript

SATB1-AS1:90

Chromosome

chr3

Gene Name

SATB1-AS1

Start

18444972

CPC Label

noncoding

End

18472803

Cancer

OV

Strand

+

Peptide

EGMIETLFLLINLDFK

Modified Peptide

n[145]EGM[147]IETLFLLINLDFK

Peptide Length

16

ORF Length

42

Open Reading Frame (ORF)

MKNPVSYIHLLCDIIKGGKEGMIETLFLLINLDFKIFYLFTA

Conservation Score

0.927

PhyloCSF Frame 1

-5.28

No. of Spectra

1

CPC Coding Probability

0.191056

PhyloCSF Frame 2 

-5.417

CNTI Index

noncoding

Max Probability

0.0808

PhyloCSF Frame 3

-4.704

CNTI Score

-0.251935325