McDonnell Genome Institute

Washington University

Transcript

SATB1-AS1:4

Chromosome

chr3

Gene Name

SATB1-AS1

Start

18445236

CPC Label

noncoding

End

18469702

Cancer

PRAD

Strand

+

Peptide

WPLDHTSSDIVIDDTVSYR

Modified Peptide

‚Äč

Peptide Length

19

ORF Length

37

Open Reading Frame (ORF)

LKMKREQFVDLRWPLDHTSSDIVIDDTVSYRKMHSLS

Conservation Score

0.745

PhyloCSF Frame 1

-5.461

No. of Spectra

1

CPC Coding Probability

0.2277

PhyloCSF Frame 2 

-5.126

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-5.722

CNTI Score

-0.315467378