McDonnell Genome Institute

Washington University

Transcript

SAP30L-AS1:13

Chromosome

chr5

Gene Name

SAP30L-AS1

Start

154432908

CPC Label

coding

End

154445822

Cancer

PRAD

Strand

-

Peptide

LQTLRPGGGMSFTLVAQAGVQWR

Modified Peptide

‚Äč

Peptide Length

23

ORF Length

226

Open Reading Frame (ORF)

LQTLRPGGGMSFTLVAQAGVQWRDLGSPQPLPPGFKRFSCFSLPSSWDYRHVPLLPANLVFLVEMGFLHVGPAGLGLPTSGDLPASASQSAGITGVSHRSQPFFMYNFVVFIQGILYHNLSPYCYVVFTVAIFYVVQCSFCSTVHCGAKDSWLCCQNWVQIWTPPMTCYNMLAIISLLESDEIGGDKFLTQCLEHHKWLINVSYHDSYRSYICPPRSWISFLCGSV

Conservation Score

0.274

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.965282

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.336181429