McDonnell Genome Institute

Washington University

Transcript

SAMMSON:23

Chromosome

chr3

Gene Name

SAMMSON

Start

69999582

CPC Label

noncoding

End

70184202

Cancer

OV

Strand

+

Peptide

LEFRVEDNPDASK

Modified Peptide

n[145]LEFRVEDNPDASK

Peptide Length

13

ORF Length

36

Open Reading Frame (ORF)

LEFRVEDNPDASKRRVGTQSFFLNRGIVEYATEPLT

Conservation Score

0.013

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0258979

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3601

PhyloCSF Frame 3

0

CNTI Score

-0.375366109