McDonnell Genome Institute

Washington University

Transcript

SAMMSON:10

Chromosome

chr3

Gene Name

SAMMSON

Start

69999732

CPC Label

noncoding

End

70105208

Cancer

PRAD

Strand

+

Peptide

HINMELR

Modified Peptide

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

LSSRSFQSGQGSRHINMELRCNLESDVKQLSKLVYTDEH

Conservation Score

1

PhyloCSF Frame 1

-4.834

No. of Spectra

1

CPC Coding Probability

0.166838

PhyloCSF Frame 2 

-4.085

CNTI Index

coding

Max Probability

0.9949

PhyloCSF Frame 3

-4.355

CNTI Score

0.607288132