McDonnell Genome Institute

Washington University

Transcript

RUSC1-AS1:1

Chromosome

chr1

Gene Name

RUSC1-AS1

Start

155320158

CPC Label

coding

End

155324176

Cancer

OV

Strand

-

Peptide

AASPPSTPPCTFWK

Modified Peptide

n[145]AASPPSTPPCTFWK

Peptide Length

14

ORF Length

93

Open Reading Frame (ORF)

LHPFAHGRGVAQTRPQRLASFVTHLEGLIYPKLLAPGSWFRAASPPSTPPCTFWKEPDSGWAEQEQNHKKVTRLFIESLLSPPLQSLGHFLRL

Conservation Score

1

PhyloCSF Frame 1

1.801

No. of Spectra

7

CPC Coding Probability

0.963567

PhyloCSF Frame 2 

3.819

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-2.274

CNTI Score

-0.327130195