McDonnell Genome Institute

Washington University

Transcript

RUNDC3A-AS1:3

Chromosome

chr17

Gene Name

RUNDC3A-AS1

Start

44299573

CPC Label

coding

End

44315315

Cancer

OV

Strand

-

Peptide

MLWGPPPKAETQSLYSNGIPFRVM

Modified Peptide

n[145]M[147]LWGPPPKAETQSLYSNGIPFRVM

Peptide Length

24

ORF Length

33

Open Reading Frame (ORF)

MQLSFAQMKMLWGPPPKAETQSLYSNGIPFRVM

Conservation Score

0.041

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.601642

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6078

PhyloCSF Frame 3

0

CNTI Score

-0.333867935