McDonnell Genome Institute

Washington University

Transcript

RRS1-AS1:8

Chromosome

chr8

Gene Name

RRS1-AS1

Start

66198965

CPC Label

noncoding

End

66430064

Cancer

OSCC

Strand

-

Peptide

LELEGPR

Modified Peptide

n[145]LELEGPR

Peptide Length

7

ORF Length

43

Open Reading Frame (ORF)

LELEGPRETIQSHIEKSKTPALTEEVLKIIKQQTNKLRPREMK

Conservation Score

0.575

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0998364

PhyloCSF Frame 2 

-5.365

CNTI Index

coding

Max Probability

0.9992

PhyloCSF Frame 3

0

CNTI Score

0.638234623