McDonnell Genome Institute

Washington University

Transcript

RPL34-AS1:1

Chromosome

chr4

Gene Name

RPL34-AS1

Start

108616408

CPC Label

noncoding

End

108620464

Cancer

EOGC

Strand

-

Peptide

LSSAWATWQNPISTK

Modified Peptide

n[145]LSSAWATWQNPISTK

Peptide Length

15

ORF Length

60

Open Reading Frame (ORF)

LSSAWATWQNPISTKNTKKLARCGGAYLWSQLLRRLRWEDYLSLGGRGCSKLRWHHCTPT

Conservation Score

0.481

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.028238

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7039

PhyloCSF Frame 3

0

CNTI Score

-0.349533928