McDonnell Genome Institute

Washington University

Transcript

RPARP-AS1:22

Chromosome

chr10

Gene Name

RPARP-AS1

Start

102451601

CPC Label

noncoding

End

102453539

Cancer

OV

Strand

+

Peptide

LTMLVLLPTCAGASRR

Modified Peptide

n[145]LTMLVLLPTCAGASRR

Peptide Length

16

ORF Length

191

Open Reading Frame (ORF)

LSETPAHQTLNRVVWEHLTASYVDPRKGGTDITPAFHSKKLLASQLVSSVFSDWSLCRLNNSSQLTQLAIVRAKFNPQSVSRLRLTMLVLLPTCAGASRRLSRSPPTLECYISALIFFFFFLRWGLALLSRLECSGMISAHCSHRLPGSSDSPTSASRGAGITGAPPPPANFCSFSRDGVFTMLARLVPNS

Conservation Score

0.459

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.113717

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6552

PhyloCSF Frame 3

0

CNTI Score

-0.364273775