McDonnell Genome Institute

Washington University

Transcript

RPARP-AS1:1

Chromosome

chr10

Gene Name

RPARP-AS1

Start

102438135

CPC Label

noncoding

End

102456289

Cancer

BRCA-Basal-like

Strand

+

Peptide

VLDSCLQFELR

Modified Peptide

n[145]VLDSCLQFELR

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

MDWATGKAGAGPGGGGHQVRAWRPRPRWELRVLDSCLQFELR

Conservation Score

0.16

PhyloCSF Frame 1

-5.667

No. of Spectra

27

CPC Coding Probability

0.134808

PhyloCSF Frame 2 

-5.222

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

0

CNTI Score

-0.344061563