McDonnell Genome Institute

Washington University

Transcript

RNF219-AS1:15

Chromosome

chr13

Gene Name

RNF219-AS1

Start

78578475

CPC Label

noncoding

End

78607096

Cancer

OV

Strand

+

Peptide

EGAGSIHYAVPWER

Modified Peptide

n[145]EGAGSIHYAVPWER

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

LEMFVRLGPTYRAPEGSEKDVHLLVREGAGSIHYAVPWER

Conservation Score

1

PhyloCSF Frame 1

-4.374

No. of Spectra

14

CPC Coding Probability

0.134682

PhyloCSF Frame 2 

-2.989

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

-3.052

CNTI Score

-0.422964698