McDonnell Genome Institute

Washington University

Transcript

RNF217-AS1:2

Chromosome

chr6

Gene Name

RNF217-AS1

Start

124909092

CPC Label

noncoding

End

124963039

Cancer

OV

Strand

-

Peptide

FNQLYSGSICDVYNFSQNGK

Modified Peptide

n[145]FNQLYSGSICDVYNFSQNGK

Peptide Length

20

ORF Length

45

Open Reading Frame (ORF)

LFWNKNDLVRFNQLYSGSICDVYNFSQNGKSATESLSSKIIKSNS

Conservation Score

1

PhyloCSF Frame 1

-3.929

No. of Spectra

6

CPC Coding Probability

0.0720564

PhyloCSF Frame 2 

-4.927

CNTI Index

noncoding

Max Probability

0.8053

PhyloCSF Frame 3

-3.518

CNTI Score

-0.36231187