McDonnell Genome Institute

Washington University

Transcript

RNF144A-AS1:3

Chromosome

chr2

Gene Name

RNF144A-AS1

Start

6912276

CPC Label

noncoding

End

6918682

Cancer

OV

Strand

-

Peptide

LSGSLTGLR

Modified Peptide

n[145]LSGSLTGLR

Peptide Length

9

ORF Length

34

Open Reading Frame (ORF)

MLSGSLTGLRDAQIAGKTVCLCASLRVFLDKISI

Conservation Score

0.075

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0245821

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9475

PhyloCSF Frame 3

-5.117

CNTI Score

-0.338416547