McDonnell Genome Institute

Washington University

Transcript

RNASEH2B-AS1:12

Chromosome

chr13

Gene Name

RNASEH2B-AS1

Start

50876460

CPC Label

noncoding

End

50910767

Cancer

EOGC

Strand

-

Peptide

ALFMLLLR

Modified Peptide

n[145]ALFMLLLR

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

LQAKLRASLAIHQRALFMLLLRNLLHFSNYLFSSFSVTRL

Conservation Score

0.021

PhyloCSF Frame 1

-4.366

No. of Spectra

1

CPC Coding Probability

0.123703

PhyloCSF Frame 2 

-5.261

CNTI Index

noncoding

Max Probability

0.4384

PhyloCSF Frame 3

-4.486

CNTI Score

-0.317490452