McDonnell Genome Institute

Washington University

Transcript

RNASEH2B-AS1:10

Chromosome

chr13

Gene Name

RNASEH2B-AS1

Start

50882463

CPC Label

noncoding

End

50891642

Cancer

OV

Strand

-

Peptide

DVHNCLLQASFCK

Modified Peptide

n[145]DVHNCLLQASFCK

Peptide Length

13

ORF Length

74

Open Reading Frame (ORF)

LALREKRKTICGICQFLWCKYSELCQFQAIHLTLLNPKLARDVHNCLLQASFCKRLETAHNEVLCIRQGNIDCK

Conservation Score

0.798

PhyloCSF Frame 1

-5.702

No. of Spectra

1

CPC Coding Probability

0.0278373

PhyloCSF Frame 2 

-5.756

CNTI Index

noncoding

Max Probability

0.7093

PhyloCSF Frame 3

-4.555

CNTI Score

-0.33606073