McDonnell Genome Institute

Washington University

Transcript

RNASEH1-AS1:22

Chromosome

chr2

Gene Name

RNASEH1-AS1

Start

3558470

CPC Label

noncoding

End

3571313

Cancer

OV

Strand

+

Peptide

MTLNEPAAFKHLFNKAHLAPPLIHLTLSGHSTCFR

Modified Peptide

n[145]MTLNEPAAFKHLFNKAHLAPPLIHLTLSGHSTCFR

Peptide Length

35

ORF Length

124

Open Reading Frame (ORF)

MTLNEPAAFKHLFNKAHLAPPLIHLTLSGHSTCFREHRVGGKVTDQQDPKAEEFFLVQNKMKSLPCLLLSTQTWQPSDFSIFSPHFPPFYSTKPPLSSWPVLNELLGTPPRRGGGRPEGLLTSQ

Conservation Score

0

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.168746

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7294

PhyloCSF Frame 3

0

CNTI Score

-0.321396611