McDonnell Genome Institute

Washington University

Transcript

RMST:37

Chromosome

chr12

Gene Name

RMST

Start

97460722

CPC Label

noncoding

End

97565035

Cancer

OV

Strand

+

Peptide

LFSFPPASEEANNEGAGK

Modified Peptide

n[145]LFSFPPASEEANNEGAGK

Peptide Length

18

ORF Length

106

Open Reading Frame (ORF)

MFNPKKRKEKLFSFPPASEEANNEGAGKEASATRVISQPQMLDKSTEAESLWDDIQKAWSDYLQEKSLPILSKVQEYSPDLLIQWSSNELLETCLRQRMHSEPQHT

Conservation Score

1

PhyloCSF Frame 1

0.408

No. of Spectra

2

CPC Coding Probability

0.361427

PhyloCSF Frame 2 

-3.107

CNTI Index

noncoding

Max Probability

0.7447

PhyloCSF Frame 3

1.979

CNTI Score

-0.333519693