McDonnell Genome Institute

Washington University

Transcript

RMST:24

Chromosome

chr12

Gene Name

RMST

Start

97462803

CPC Label

noncoding

End

97530859

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LDEALEVLVK

Modified Peptide

n[145]LDEALEVLVK

Peptide Length

10

ORF Length

48

Open Reading Frame (ORF)

LDEALEVLVKGRMTWAIPNVELSSISIPICIICYSQDDGVSDGIGCQL

Conservation Score

1

PhyloCSF Frame 1

-5.517

No. of Spectra

14

CPC Coding Probability

0.0812512

PhyloCSF Frame 2 

-4.552

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-1.934

CNTI Score

-0.414750715