McDonnell Genome Institute

Washington University

Transcript

RMST:12

Chromosome

chr12

Gene Name

RMST

Start

97523962

CPC Label

noncoding

End

97527733

Cancer

OV

Strand

+

Peptide

ELGMAWK

Modified Peptide

n[145]ELGM[147]AWK

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

MLLLLLLNRFLVRFTNLPKVPELVSKELGMAWKQDV

Conservation Score

0.013

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0631135

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7374

PhyloCSF Frame 3

0

CNTI Score

-0.348611811