McDonnell Genome Institute

Washington University

Transcript

RMST:10

Chromosome

chr12

Gene Name

RMST

Start

97492636

CPC Label

noncoding

End

97493980

Cancer

OSCC

Strand

+

Peptide

LMLLACFSNSFNAIK

Modified Peptide

n[145]LM[147]LLACFSNSFNAIK

Peptide Length

15

ORF Length

40

Open Reading Frame (ORF)

LFLFLHLCLSRKVERLMLLACFSNSFNAIKCTPNLTHSLS

Conservation Score

0.981

PhyloCSF Frame 1

0

No. of Spectra

97

CPC Coding Probability

0.0163807

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9877

PhyloCSF Frame 3

0

CNTI Score

-0.52961591