McDonnell Genome Institute

Washington University

Transcript

RMDN2-AS1:10

Chromosome

chr2

Gene Name

RMDN2-AS1

Start

38029823

CPC Label

noncoding

End

38036267

Cancer

CCRC

Strand

-

Peptide

MLLGDISR

Modified Peptide

n[230]MLLGDISR

Peptide Length

8

ORF Length

64

Open Reading Frame (ORF)

MLLGDISRISLRLLRMILCDCTKYFLSCILRCCRSYFIIKKTAWELKPRNGIRIIISRQKQATG

Conservation Score

0.997

PhyloCSF Frame 1

-3.838

No. of Spectra

1

CPC Coding Probability

0.175508

PhyloCSF Frame 2 

-4.805

CNTI Index

noncoding

Max Probability

0.7128

PhyloCSF Frame 3

-4.991

CNTI Score

-0.425782153