McDonnell Genome Institute

Washington University

Transcript

RFX3-AS1:17

Chromosome

chr9

Gene Name

RFX3-AS1

Start

3548680

CPC Label

noncoding

End

3549736

Cancer

OV

Strand

+

Peptide

MVQSSSLSGGAR

Modified Peptide

n[145]M[147]VQSSSLSGGAR

Peptide Length

12

ORF Length

56

Open Reading Frame (ORF)

MVQSSSLSGGARSVAGQAREYAGGWLRFYGKAYLYYTISRQTPGCVSPGSAESGLQ

Conservation Score

0.032

PhyloCSF Frame 1

-4.099

No. of Spectra

7

CPC Coding Probability

0.109151

PhyloCSF Frame 2 

-4.184

CNTI Index

noncoding

Max Probability

0.9547

PhyloCSF Frame 3

-5.686

CNTI Score

-0.422704614