McDonnell Genome Institute

Washington University

Transcript

RFX3-AS1:13

Chromosome

chr9

Gene Name

RFX3-AS1

Start

3526484

CPC Label

noncoding

End

3537928

Cancer

OV

Strand

+

Peptide

HNFFVFFFFTFFK

Modified Peptide

n[145]HNFFVFFFFTFFK

Peptide Length

13

ORF Length

48

Open Reading Frame (ORF)

MTTESAFLTAMLNYLPLVSNPTPNPFASKKHNFFVFFFFTFFKLYFKF

Conservation Score

0.13

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0858295

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.4742

PhyloCSF Frame 3

0

CNTI Score

0.580102325