McDonnell Genome Institute

Washington University

Transcript

RFX3-AS1:12

Chromosome

chr9

Gene Name

RFX3-AS1

Start

3526121

CPC Label

coding

End

3654131

Cancer

CCRC

Strand

+

Peptide

DSAFCVLYFESK

Modified Peptide

DSAFCVLYFESK

Peptide Length

12

ORF Length

52

Open Reading Frame (ORF)

LWFWNYSEGSWMKTKDSAFCVLYFESKGPPIWGPSHFLYSFTGKGQFRESTK

Conservation Score

0.254

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.73399

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9927

PhyloCSF Frame 3

-5.381

CNTI Score

0.650129821