McDonnell Genome Institute

Washington University

Transcript

RFX3-AS1:1

Chromosome

chr9

Gene Name

RFX3-AS1

Start

3526118

CPC Label

noncoding

End

3532720

Cancer

CCRC

Strand

+

Peptide

LGGQAMR

Modified Peptide

n[230]LGGQAMR

Peptide Length

7

ORF Length

34

Open Reading Frame (ORF)

LGGQAMRITGGQEFETSLSNIARLCLYKKKLKLS

Conservation Score

0.026

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0621615

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9955

PhyloCSF Frame 3

0

CNTI Score

0.650129821