McDonnell Genome Institute

Washington University

Transcript

RFPL1S:23

Chromosome

chr22

Gene Name

RFPL1S

Start

29452132

CPC Label

noncoding

End

29480889

Cancer

LUAD

Strand

-

Peptide

MSLAQVSK

Modified Peptide

n[230]M[147]SLAQVSK

Peptide Length

8

ORF Length

35

Open Reading Frame (ORF)

LRFSKLHPLRKSNERKSATLLRMSLAQVSKDRPSV

Conservation Score

0.807

PhyloCSF Frame 1

-4.675

No. of Spectra

2

CPC Coding Probability

0.0984807

PhyloCSF Frame 2 

-4.24

CNTI Index

noncoding

Max Probability

0.9965

PhyloCSF Frame 3

-4.968

CNTI Score

-0.248706659