McDonnell Genome Institute

Washington University

Transcript

RBPMS-AS1:3

Chromosome

chr8

Gene Name

RBPMS-AS1

Start

30384426

CPC Label

noncoding

End

30385159

Cancer

OV

Strand

-

Peptide

GELGLGAAAAGRR

Modified Peptide

n[145]GELGLGAAAAGRR

Peptide Length

13

ORF Length

211

Open Reading Frame (ORF)

LGRGAGRGRASPLEPSPGAGAPSGGRRGLWGWSWSRGSGCRARVGLGLPRRVCDGGGGRLRKCKGETGQGAGRERGTETIGPREGDLEREGGSQGRKEEGRKEGSKGWGEDARPRSKRGELGLGAAAAGRRGRGCLERRRRRKRRRRSGAEERGPRLGRWDPRAAEYALQAGSGKSGMEAAPFLSPSSLPSPLPPLRASPPPSALPGRGLP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.14427

PhyloCSF Frame 2 

5.3

CNTI Index

noncoding

Max Probability

0.488

PhyloCSF Frame 3

4.992

CNTI Score

-0.296561617