McDonnell Genome Institute

Washington University

Transcript

RBM15-AS1:21

Chromosome

chr1

Gene Name

RBM15-AS1

Start

110282598

CPC Label

coding

End

110339156

Cancer

CCRC

Strand

-

Peptide

MGMIITEHLK

Modified Peptide

n[43]M[147]GMIITEHLK

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

MGMIITEHLKHTHYYAQFFTQNVLSQLILPALL

Conservation Score

0.065

PhyloCSF Frame 1

-5.696

No. of Spectra

8

CPC Coding Probability

0.86364

PhyloCSF Frame 2 

-5.099

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-4.43

CNTI Score

-0.322023898