McDonnell Genome Institute

Washington University

Transcript

RASSF8-AS1:42

Chromosome

chr12

Gene Name

RASSF8-AS1

Start

25944659

CPC Label

noncoding

End

25958360

Cancer

OV

Strand

-

Peptide

DCLRPEVQDQSK

Modified Peptide

n[145]DCLRPEVQDQSK

Peptide Length

12

ORF Length

57

Open Reading Frame (ORF)

LDKVFIEDRGPVVAHACNPRWKDCLRPEVQDQSKQHSKAPSLQKMKIKLAERDGSCL

Conservation Score

0.809

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0304527

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9561

PhyloCSF Frame 3

0

CNTI Score

-0.377027439