McDonnell Genome Institute

Washington University

Transcript

RARA-AS1:2

Chromosome

chr17

Gene Name

RARA-AS1

Start

40340868

CPC Label

noncoding

End

40343136

Cancer

OSCC

Strand

-

Peptide

GSGASPGILR

Modified Peptide

n[145]GSGASPGILR

Peptide Length

10

ORF Length

141

Open Reading Frame (ORF)

LCVLGGGVRRLSQGSLAGPGNSAASPRGDSRLESRGVRGRVQRLPKSAGRGRDQRGAGGQRALPPPSRGSGASPGILRGEDSGWGWGSRAVPPPPGQGQLATRSVSGGTRHGPPTPALRAPSPPGTTPFPPPRPVQAPPLA

Conservation Score

1

PhyloCSF Frame 1

2.579

No. of Spectra

2

CPC Coding Probability

0.165964

PhyloCSF Frame 2 

0.687

CNTI Index

noncoding

Max Probability

0.6592

PhyloCSF Frame 3

0

CNTI Score

-0.281371563