McDonnell Genome Institute

Washington University

Transcript

RAMP2-AS1:22

Chromosome

chr17

Gene Name

RAMP2-AS1

Start

42752879

CPC Label

noncoding

End

42753799

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LSAKPAPPKPQPKPK

Modified Peptide

n[145]LSAKPAPPKPQPKPK

Peptide Length

15

ORF Length

88

Open Reading Frame (ORF)

MPKRKAKGDAKGDKAKRRSTRLSAKPAPPKPQPKPKKAPAKKGEKIPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGVAKASDE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.139835

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9781

PhyloCSF Frame 3

0

CNTI Score

-0.321934297