McDonnell Genome Institute

Washington University

Transcript

RAMP2-AS1:21

Chromosome

chr17

Gene Name

RAMP2-AS1

Start

42759552

CPC Label

noncoding

End

42760973

Cancer

OV

Strand

-

Peptide

IISTMMQK

Modified Peptide

n[145]IISTMMQK

Peptide Length

8

ORF Length

99

Open Reading Frame (ORF)

MGTDNLLSSSMVKRLLLQRIQWERVNGLLDVNSKVLLVRIISTMMQKRAMQSLRHFRLGPNLVLPACLGLLLSRRKHGRFLSDKMGGRSKEVQKAKQAI

Conservation Score

0.858

PhyloCSF Frame 1

-2.516

No. of Spectra

21

CPC Coding Probability

0.211218

PhyloCSF Frame 2 

-4.576

CNTI Index

noncoding

Max Probability

0.9036

PhyloCSF Frame 3

-3.342

CNTI Score

-0.353137201