McDonnell Genome Institute

Washington University

Transcript

RAMP2-AS1:19

Chromosome

chr17

Gene Name

RAMP2-AS1

Start

42751288

CPC Label

noncoding

End

42760973

Cancer

OV

Strand

-

Peptide

DSLTLTHMATLAQKPCGMEK

Modified Peptide

n[145]DSLTLTHM[147]ATLAQKPCGM[147]EK

Peptide Length

20

ORF Length

72

Open Reading Frame (ORF)

LMWGKHISLPVLKDFLLAPRRRDSLTLTHMATLAQKPCGMEKQIRFYVLFSLSILQHRLNSLKPRHLLGPDL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0620428

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8172

PhyloCSF Frame 3

0

CNTI Score

-0.317267878