McDonnell Genome Institute

Washington University

Transcript

RALY-AS1:5

Chromosome

chr20

Gene Name

RALY-AS1

Start

33992487

CPC Label

noncoding

End

33994355

Cancer

BRCA-Luminal A

Strand

-

Peptide

LPEEAVGGAGGIR

Modified Peptide

n[145]LPEEAVGGAGGIR

Peptide Length

13

ORF Length

44

Open Reading Frame (ORF)

LPEEAVGGAGGIRKRRGRKKLLVLSLLRNVPPRQVFQPPVNQSS

Conservation Score

0.876

PhyloCSF Frame 1

-0.949

No. of Spectra

2

CPC Coding Probability

0.128305

PhyloCSF Frame 2 

-4.387

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-3.237

CNTI Score

-0.350820017