McDonnell Genome Institute

Washington University

Transcript

RALY-AS1:17

Chromosome

chr20

Gene Name

RALY-AS1

Start

33980742

CPC Label

coding

End

33993133

Cancer

EOGC

Strand

-

Peptide

LEGCDSGVAR

Modified Peptide

n[145]LEGCDSGVAR

Peptide Length

10

ORF Length

62

Open Reading Frame (ORF)

LVRAMSVSFKLGQLEISPGTFYTKTNGEMFSELQELLKLEGCDSGVARVHLPLPVEKSACDW

Conservation Score

0.894

PhyloCSF Frame 1

-4.962

No. of Spectra

14

CPC Coding Probability

0.81785

PhyloCSF Frame 2 

-3.126

CNTI Index

noncoding

Max Probability

0.9827

PhyloCSF Frame 3

-4.451

CNTI Score

-0.334731327