McDonnell Genome Institute

Washington University

Transcript

RALY-AS1:13

Chromosome

chr20

Gene Name

RALY-AS1

Start

33989601

CPC Label

noncoding

End

33994428

Cancer

HCC

Strand

-

Peptide

AGAGDPGR

Modified Peptide

n[230]AGAGDPGR

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

LAQTWPAERADRERREQDRARRAGAGDPGRRVRVGERSGGGGLELLGLPGLPEGQK

Conservation Score

0.999

PhyloCSF Frame 1

0

No. of Spectra

22

CPC Coding Probability

0.0422227

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.268884835