McDonnell Genome Institute

Washington University

Transcript

RAB30-AS1:4

Chromosome

chr11

Gene Name

RAB30-AS1

Start

83072072

CPC Label

noncoding

End

83094435

Cancer

LUAD

Strand

+

Peptide

LLVVTLYIDGK

Modified Peptide

n[230]LLVVTLYIDGK

Peptide Length

11

ORF Length

72

Open Reading Frame (ORF)

LLVVTLYIDGKGRAELESNYLTCSVSLMIQQAHHCFSLLFKQWIFFVMILISCIMQFNTCLILMLDSQFLRQ

Conservation Score

0.289

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0657006

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9944

PhyloCSF Frame 3

0

CNTI Score

0.589152046