McDonnell Genome Institute

Washington University

Transcript

RAB30-AS1:15

Chromosome

chr11

Gene Name

RAB30-AS1

Start

83072117

CPC Label

noncoding

End

83073383

Cancer

OV

Strand

+

Peptide

ISWAWWCTPVVAATLEAEVGGSLEPGMLR

Modified Peptide

n[145]ISWAWWCTPVVAATLEAEVGGSLEPGM[147]LR

Peptide Length

29

ORF Length

49

Open Reading Frame (ORF)

LGNMRRPRTVSTKTLNKKISWAWWCTPVVAATLEAEVGGSLEPGMLRLQ

Conservation Score

0.019

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0329171

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7172

PhyloCSF Frame 3

0

CNTI Score

-0.354864579