McDonnell Genome Institute

Washington University

Transcript

RAB11B-AS1:6

Chromosome

chr19

Gene Name

RAB11B-AS1

Start

8361554

CPC Label

noncoding

End

8390663

Cancer

OV

Strand

-

Peptide

AQLTAGALR

Modified Peptide

n[145]AQLTAGALR

Peptide Length

9

ORF Length

61

Open Reading Frame (ORF)

LTGGPARAQAPLQRAQLTAGALRVFAQPLAELQESVRQDIHLVPGRKARRLGLHGSALSAQ

Conservation Score

1

PhyloCSF Frame 1

12.101

No. of Spectra

2

CPC Coding Probability

0.366783

PhyloCSF Frame 2 

-5.566

CNTI Index

noncoding

Max Probability

0.6184

PhyloCSF Frame 3

-4.664

CNTI Score

-0.273023675