McDonnell Genome Institute

Washington University

Transcript

PXN-AS1:4

Chromosome

chr12

Gene Name

PXN-AS1

Start

120201326

CPC Label

noncoding

End

120210519

Cancer

OV

Strand

+

Peptide

LDTFTIRGPR

Modified Peptide

n[145]LDTFTIRGPR

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

LDTFTIRGPRTGALDLTGAKRKHANPDMTTRRQ

Conservation Score

0.971

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.011217

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1517

PhyloCSF Frame 3

0

CNTI Score

-0.323334221