McDonnell Genome Institute

Washington University

Transcript

PVT1:82

Chromosome

chr8

Gene Name

PVT1

Start

128049408

CPC Label

noncoding

End

128113581

Cancer

PRAD

Strand

+

Peptide

EVVMLCMFNEIMHLKPFEQCMEK

Modified Peptide

EVVM[147]LCMFNEIMHLKPFEQCM[147]EK

Peptide Length

23

ORF Length

83

Open Reading Frame (ORF)

MEVVMLCMFNEIMHLKPFEQCMEKTQEVPAITVFLSLLLLVSCYFSPHQPHQITYSLTILMILHAPLLLHLISSAQRSLSLTY

Conservation Score

0.051

PhyloCSF Frame 1

-4.995

No. of Spectra

10

CPC Coding Probability

0.130889

PhyloCSF Frame 2 

-4.517

CNTI Index

noncoding

Max Probability

0.6578

PhyloCSF Frame 3

-4.967

CNTI Score

-0.343021188