McDonnell Genome Institute

Washington University

Transcript

PVT1:79

Chromosome

chr8

Gene Name

PVT1

Start

127983897

CPC Label

noncoding

End

128188211

Cancer

OV

Strand

+

Peptide

ILITLCLSLCFVSEVLLLPPPPFPK

Modified Peptide

n[145]ILITLCLSLCFVSEVLLLPPPPFPK

Peptide Length

25

ORF Length

34

Open Reading Frame (ORF)

LKFLKILITLCLSLCFVSEVLLLPPPPFPKCAQD

Conservation Score

0.04

PhyloCSF Frame 1

-4.815

No. of Spectra

5

CPC Coding Probability

0.130867

PhyloCSF Frame 2 

-3.035

CNTI Index

noncoding

Max Probability

0.9937

PhyloCSF Frame 3

-4.841

CNTI Score

-0.330610024