McDonnell Genome Institute

Washington University

Transcript

PVT1:21

Chromosome

chr8

Gene Name

PVT1

Start

127855147

CPC Label

noncoding

End

127932688

Cancer

EOGC

Strand

+

Peptide

AWPLAVDSLWLGGNVR

Modified Peptide

n[145]AWPLAVDSLWLGGNVR

Peptide Length

16

ORF Length

72

Open Reading Frame (ORF)

LVKHLMHVPSGAQLGLRFLGTPPWRAWPLAVDSLWLGGNVRSGACLFAGNAVHSQPTCPMPALEAGEAQPWV

Conservation Score

0.273

PhyloCSF Frame 1

0.672

No. of Spectra

2

CPC Coding Probability

0.344564

PhyloCSF Frame 2 

-2.899

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

-1.773

CNTI Score

-0.347458788