McDonnell Genome Institute

Washington University

Transcript

PURPL:38

Chromosome

chr5

Gene Name

PURPL

Start

27472300

CPC Label

noncoding

End

27491560

Cancer

OSCC

Strand

+

Peptide

VNIVLELIHK

Modified Peptide

n[145]VNIVLELIHK

Peptide Length

10

ORF Length

45

Open Reading Frame (ORF)

MRVNIVLELIHKCILLPFYINVIVDALIFSEGWGKIAIPTLMSVC

Conservation Score

0.395

PhyloCSF Frame 1

-3.569

No. of Spectra

4

CPC Coding Probability

0.082942

PhyloCSF Frame 2 

-5.404

CNTI Index

noncoding

Max Probability

0.9062

PhyloCSF Frame 3

-5.685

CNTI Score

-0.382066129