McDonnell Genome Institute

Washington University

Transcript

PTPRG-AS1:7

Chromosome

chr3

Gene Name

PTPRG-AS1

Start

62263928

CPC Label

noncoding

End

62318935

Cancer

OV

Strand

-

Peptide

LTCPVLVMISLLTEAVPQK

Modified Peptide

n[145]LTCPVLVM[147]ISLLTEAVPQK

Peptide Length

19

ORF Length

77

Open Reading Frame (ORF)

LTCPVLVMISLLTEAVPQKQTCNRRNRSQCHPSAVVTSKKVSRHGQMSPGGQNHPQLRTTALNYGVSLCHPGWSTVA

Conservation Score

0.26

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.159613

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6703

PhyloCSF Frame 3

0

CNTI Score

-0.410060345