McDonnell Genome Institute

Washington University

Transcript

PTPRG-AS1:11

Chromosome

chr3

Gene Name

PTPRG-AS1

Start

62276426

CPC Label

noncoding

End

62318892

Cancer

BRCA-Luminal A

Strand

-

Peptide

LYLSGNGARPTR

Modified Peptide

n[145]LYLSGNGARPTR

Peptide Length

12

ORF Length

114

Open Reading Frame (ORF)

LYLSGNGARPTRARSAIIWKKQKHHICLIIHTEPTALSEICLMNNISSWLPFLRLIYIFKQAKVLSAEAECKMKFCCTYPEGHRHCRNTVLLWERFLQQINNRILYMDTTEDFR

Conservation Score

1

PhyloCSF Frame 1

13.604

No. of Spectra

54

CPC Coding Probability

0.0439558

PhyloCSF Frame 2 

-3.143

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-4.301

CNTI Score

-0.35712999